PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G008629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family NAC
Protein Properties Length: 627aa    MW: 70491.5 Da    PI: 4.3125
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G008629.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.5e-52161422128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                           ppGfrFhPtdeel+ +yLk+k+ gk+l+l +vi+e+d+yk++P++Lp +  +k+++++w+fFs+rd+ky++g r+nr t++gyWkatgk
  HL.SW.v1.0.G008629.1  16 PPGFRFHPTDEELILYYLKRKICGKRLRL-NVIAETDVYKWDPEELPgMsLLKTGDRQWFFFSPRDRKYPNGARSNRGTRHGYWKATGK 103
                           8****************************.99***************6347788999******************************** PP

                   NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           d++++s +++ vg+kktLvfykgrap+ge+tdWvmhey+l
  HL.SW.v1.0.G008629.1 104 DRNITS-SSRSVGVKKTLVFYKGRAPHGERTDWVMHEYTL 142
                           ******.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-6013165IPR003441NAC domain
PROSITE profilePS5100555.91215165IPR003441NAC domain
PfamPF023652.5E-2716142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MVSSDNLGLS DGQDWPPGFR FHPTDEELIL YYLKRKICGK RLRLNVIAET DVYKWDPEEL  60
PGMSLLKTGD RQWFFFSPRD RKYPNGARSN RGTRHGYWKA TGKDRNITSS SRSVGVKKTL  120
VFYKGRAPHG ERTDWVMHEY TLDEEELKRC QNIQEYFALY KVFKKSGPGP KNGEQYGAPF  180
REEDWNADCP DFNCSTNMET PVERTDGVLS NVESRESIVD SQKSISDEID ELLQQISEGP  240
LPDLPEVEDY AYTPPSQVVS NNDMQSNLVD PLCREISFQE PVNLLQASGE QHNVHGNFEY  300
SHSDISQSQC HVSPEVAFSP NTHEQEVYVL PEEDFIEMDD LFLPEPTTTD AEKPNENFQL  360
EDLDGLSELD FHDATMFLND IGANDQSTIS HQHVNSLEQN VLDPYEFQRN FEQVGDGEVV  420
NQLCFDVPYQ NTMVYLEGAA VVNNHMYLEG TAPINNPQYQ DISNQMNHRY ELQSDDQERS  480
AITSADFDPG FHPDPSSGVV CDTSTISLQA TQNQSGNDNS GNESWFTSAI WSFVESIPTT  540
PASAAENALV NRAFERMSSF SRLRINAAVN ATNVPAGSDS ETKKSSSRNR GFIFFPILVV  600
VIAILWVVLG TVKLWGSSSS SSSIAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-511614216140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886100.10.0PREDICTED: NAC domain-containing protein 17-like
TrEMBLW9QXU40.0W9QXU4_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-133NAC domain containing protein 17